PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009625571.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 351aa    MW: 40461.2 Da    PI: 6.0113
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009625571.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.14.3e-50111391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yL+kk+++ +++l +vi evd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk +
  XP_009625571.1  11 VPPGFRFHPTEEELLHYYLRKKITNVRIDL-DVICEVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVI 104
                     69****************************.99**************964444222455************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +  + + +g++ktLvfykgrap+g+k dW+mheyrl
  XP_009625571.1 105 YG-NCKRIGMRKTLVFYKGRAPHGVKLDWIMHEYRL 139
                     *9.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-588171IPR003441NAC domain
PROSITE profilePS5100555.311171IPR003441NAC domain
PfamPF023656.9E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MNLSVNGQSQ VPPGFRFHPT EEELLHYYLR KKITNVRIDL DVICEVDLNK LEPWDIQEKC  60
KIGSTPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKVIYGNCKR IGMRKTLVFY  120
KGRAPHGVKL DWIMHEYRLD DNTTPNEAVN FCASESAAQE EGWVVCRVFK KKNYNKALEI  180
PQSSSVVSNT DGVLDQILTY MGRSCKQQHN QTQHISNILQ FNNNENIEFD TNMLQISSTG  240
IGEGSFLHLP ELEIRHPTTN MEQIIHQDCS FDEIMSSTET NQHYSCMSNY HEDRDKKADW  300
VAQLNGHLQT SSNNLYLTQC YESHELAQND DDVDVEFLTY AQSSPLNNLL V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-501117315170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625571.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-110NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM1A5171e-150M1A517_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000148721e-150(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-101NAC family protein